DPCstruct | MC14484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7LNP0 | 5-68 | PQYSLVETEIREIIKQNGPISFAHFMELALYHPQCGYYINKAGFGPNGDFFTAPMTHPIFGSLI |
| A0A212FPE8 | 6-79 | EAPSIMDILKEKIRLNGPITVAEYMHIVITNPTEGYYMKKDVIGQTGDFVTSPEITQLFGEILAVWFFAETQKM |
| A0A5A7ND34 | 3-63 | None |
| A0A287L0R9 | 108-185 | None |
| A0A0A9YWD8 | 30-99 | None |
| A0A0B7FCA3 | 468-545 | None |
| A0A2G5UGP1 | 21-97 | None |
| A0A6I9PKB8 | 46-118 | None |
| A0A0N4T7J1 | 29-89 | None |
| A0A453EZ59 | 121-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.