DPCstruct | MC14482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7LM14 | 4-93 | KVSKEWIANKTRYRGTIKASYFELVRLFGEPQKGDGFKTQAEWHIEFEDGVITTIYDWKFYRPVEYNNSWNVGGTEPSSLTKLESLM… |
| A0A351GHX4 | 14-108 | EKTTGTFLVGRLFGLMYDDLVGILGQPTFARASSDDKVQKEWVIEFNDNIYTIYDWCTYDEDYTMDNLKDWNIGGFTSIDTDELINY… |
| A0A7J2R125 | 10-104 | None |
| A0A1I5YNT8 | 14-111 | None |
| A0A842NQF5 | 17-143 | None |
| A0A382CCQ1 | 3-117 | None |
| A0A2E6JNU8 | 8-96 | None |
| A0A2E9F9D9 | 6-90 | None |
| A0A2D6TZV9 | 33-132 | None |
| A0A2E8DYX5 | 48-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.