DPCstruct | MC14481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 155 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R4F3 | 3-156 | LLRVIAVLLLPLALALAHATTVLHFYTTGDVERLRAALIRPYSSLEEAFHAATGLAALGEQLPDEQSACEFINAELDPSDVHSVYYA… |
| A0A1S3IX42 | 2-138 | GQALTPSSYISAADQTRLRSVFEAAAPYSDVEVAHYSIMGLTLLGVVIPNSKDVCNYLQVNLDQSSVESLFFASSAAKNLGGCQLTA… |
| A0A182ESE5 | 1-165 | None |
| A0A183V8C3 | 2-158 | None |
| A0A5B7E4V7 | 2-152 | None |
| A0A4S2KXB8 | 1-165 | None |
| A0A4Y2BQN9 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.