DPCstruct | MC14479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 377 ± 58 aa |
| Standard deviation of domain lengths | 58.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521G1D7 | 4-376 | SPSEQIALTVRAADNMTEVFLADSRFELIANGIGRTEATVAPGLYKARFRVGQVQTDSLIEVETGGASKIFDGTAVQFASPVPMPQT… |
| A0A1G3GRN2 | 1-368 | MSKLTFSAVVKGAFRVNVIGPRPNDVFTVMLIGSGDERELELDDGEYFAHVTDLSTGAEDRFPVVVDRNNHQIVRVQMSQATALSTG… |
| A0A7Y5KW46 | 353-743 | None |
| A0A1T4XYG1 | 184-496 | None |
| A0A7X7XN45 | 48-400 | None |
| A0A117MPZ5 | 3-378 | None |
| A0A143PQG0 | 12-495 | None |
| A0A5C6V973 | 2-323 | None |
| A0A831WD47 | 100-445 | None |
| A0A6I4SVY9 | 244-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.