DPCstruct | MC14477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 164 ± 31 aa |
| Standard deviation of domain lengths | 30.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF04434- PF02617- PF02207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2NKK1 | 4-186 | ISGRMNTIIIKGLLVSSNDTGTHVREIFTIDRLESLVGVALEEYIFEEVGPDIQKWFFSEHCNLGMCTNVISAGDAIYSCLECQQHD… |
| A0A444TZ31 | 15-145 | AAHLKADLNRTDNSSGVHQLQELLDSVLNPERPAGDTEALEWCKCLLAGGEEFEEFCKTVRSYDNATLCGLVWTANFVAYRCRTCGI… |
| A0A182J7J5 | 13-138 | None |
| B4H3V1 | 154-326 | None |
| A0A2H2IT18 | 50-243 | None |
| A0A7R9B0N1 | 5-131 | None |
| A0A6J3C282 | 33-250 | None |
| A0A4C1U753 | 10-111 | None |
| A0A813US08 | 64-245 | None |
| A0A2W1BT50 | 18-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.