DPCstruct | MC14473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 163 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2ICA4 | 1-164 | MKHCLRTVFKLIPIQKYLNNAISSINANPSDYSRIESCLFFITGMITDTSLPVDFNEALKLILSYKPNSPSLLLETCCRFLRDFVHQ… |
| A0A0C2N2P2 | 1-147 | MRECLRTVFQVIPFQPHFNNAISIIRQNPGYFSRIESQLFFITGMITETSVLSDFHEVLEIILNFPHDAPSFFIETCCDVLRDFIYH… |
| A0A0C2MEU4 | 121-267 | None |
| A0A0C2MN89 | 34-196 | None |
| A0A0C2MLJ8 | 1-195 | None |
| A0A0C2MJ39 | 22-176 | None |
| A0A0C2M7H0 | 53-198 | None |
| A0A0C2MB84 | 22-214 | None |
| A0A0C2I5G0 | 1-145 | None |
| A0A0C2NF45 | 16-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.