DPCstruct | MC14471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2J2I3 | 35-158 | EDYITNTTSTDISTLISAVRKFMSETKKYKNYVVNSEFIIFFPRQLYRRFEEMSTLDANVTGYLEMKVLCSDVFIFIFRHFDEFIEV… |
| A0A0C2N1J2 | 2-113 | ALDFYILKSQMNNIYYQMEAIRCAIYYFLPQCHIRADLIFIQHFSHDVYKELQRMSEGDTNVERYQDKKMLFFDIFTFIFRNHHLVS… |
| A0A0C2MRL0 | 3-123 | None |
| A0A0C2MR79 | 13-138 | None |
| A0A0C2MNN5 | 3-148 | None |
| A0A0C2MC36 | 11-126 | None |
| A0A0C2M858 | 1-132 | None |
| A0A0C2J0W6 | 2-125 | None |
| A0A0C2NBN6 | 16-132 | None |
| A0A0C2N4T9 | 9-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.