DPCstruct | MC14470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2M6G2 | 1-137 | MKTMAELRREHNLPIPVNKDSLYKPIERTLKKFNPLVIPKSLQATLPFESKPKDIPKGRPTLERRRAVVMEPDERKVHALVQQLRLI… |
| A0A0C2N1C7 | 9-140 | WSGMRTAADLRKEAGIKLELNKDSLYKPINRTPIIFAPLTVPEKLTKQLPFSSRPKNIMNPQNKPKRPKLTNPMDRKASSLINELSL… |
| A0A7J9GAY9 | 31-170 | None |
| A0A0B1T2J2 | 1-126 | None |
| A0A1A8KDV3 | 611-766 | None |
| A0A2P6RQU4 | 1-120 | None |
| T1GRK7 | 67-201 | None |
| A0A1C7NL87 | 4-143 | None |
| A0A834LE01 | 92-241 | None |
| A0A821T8N7 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.