DPCstruct | MC14469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MJ71 | 46-174 | KPLTPLVDQFDSIEVIQNPIRPNFSLFFAKNSHSPEKNAFYRYDPKKPAFELVTLKTSAELVKLSKVVPAGKKMLCISNEDHIAFYI… |
| A0A0C2MWT6 | 3-104 | PNFSLFFAKNSHSPEKSALYRYDPNKRAFESVTLKTSAGLVKLSKVVPAGEKMFCISDEDHFAFYINEKLEVEHEQKLLLQHEYVPH… |
| A0A0C2M7N4 | 85-189 | None |
| A0A0C2MRK9 | 2-135 | None |
| A0A0C2MHB1 | 109-246 | None |
| A0A0C2MFB2 | 6-123 | None |
| A0A0C2ME77 | 36-181 | None |
| A0A0C2M9N8 | 22-150 | None |
| A0A0C2M9D3 | 48-161 | None |
| A0A0C2M976 | 36-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.