DPCstruct | MC14468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 367 ± 74 aa |
| Standard deviation of domain lengths | 73.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DZ20 | 386-775 | VMEHPLRVRVFCAQVRAGMWRKNGDAAILSAEWYRSVQWLEQGLESDLFLLQCCAALSSPEFFVKTIQERFGLSNYISLVLTEQNEY… |
| A0A0C2MVD4 | 12-371 | SIRDKVCEDDKILMWIARSSVTAISFVSSSFDLPQNTIKKYWGQPIALYFKPALDHYLHIHNFHTIQILMSHLDPELLLKYLLFNVM… |
| A0A0C2MM33 | 46-450 | None |
| A0A0C2MJD2 | 182-617 | None |
| A0A0C2MCC4 | 3-315 | None |
| A0A0C2M4M6 | 45-433 | None |
| A0A0C2JYY4 | 262-650 | None |
| A0A0C2IYV4 | 80-390 | None |
| A0A453DYX3 | 336-720 | None |
| A0A0C2IVZ2 | 58-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.