DPCstruct | MC14467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 148 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MRJ8 | 194-345 | QVIKDLSKTWISIINVFGDRLEFDYTQEMMFASCVYSVYFINKLRKVNDGSGHFEMTKITKQGVLIIYFTLYAYPWMKNRSKRWLRN… |
| A0A0C2MT36 | 3-156 | LRNLSKIWSCILNGSRNIFKIDTIDKLIIFATLFSMDIGAKLLKVFHGSVNFELTKYAKQKLFIIYLLLVAYPIVDEEDNAWLWVVI… |
| A0A0C2J594 | 58-211 | None |
| A0A0C2MJH9 | 192-342 | None |
| A0A0C2JU51 | 76-230 | None |
| A0A0C2IVF8 | 39-189 | None |
| A0A0C2JAR6 | 129-280 | None |
| A0A0C2N7A6 | 129-277 | None |
| A0A0C2N6R1 | 41-190 | None |
| A0A0C2N2G3 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.