DPCstruct | MC14466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 638 ± 121 aa |
| Standard deviation of domain lengths | 120.63 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 88.06 |
| Assigned Pfam label(s) | CL0023- PF11987- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2V7B0 | 62-689 | PEEAPPIVVAVVGPPGVGKTTLVKSLIKRYTKQTLSSPAGPLTVVTSKRRRLTFLECPSDSLASMIDVAKIADIVLLMIDGNYGFEM… |
| A0A0C2MS85 | 2-667 | IDLAKITDIVILVVDATFDFEIENFELFNILHAHSLPKVITVLTHLDLILTNKSLTKYKKSIKRTLWQNVYEGAKLLSFSGFRNNLY… |
| L1J886 | 16-627 | None |
| A0A7J0GIF0 | 36-595 | None |
| A0A7R8WBP7 | 90-721 | None |
| F0WZ97 | 300-958 | None |
| A0A7S1NNU2 | 1-512 | None |
| A7AMX6 | 84-775 | None |
| A0A0B1PJ11 | 326-959 | None |
| A0A5B7CLG8 | 148-794 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.