DPCstruct | MC14465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 24.51 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4UAU9 | 2-102 | REFLDEFYAAVRKGDAAALITDEPPPVPDDREHASLGAIGEHLARRWHLPIPAWTDDPSRFLRRPYFTTSIEGLKALLLVESPLAFR… |
| A0A1G7CM31 | 17-178 | QAEAKEASAQELLVPSAARVTEQPAGQDFSAYGAAAAAQEILNRDGCLNDVWRFCVLQTIDYYNMAVKFQWDVAEVFREQPETDVAP… |
| A0A4R3S3C9 | 19-169 | None |
| A0A1G7E1M1 | 5-81 | None |
| A0A5C7WQZ5 | 81-247 | None |
| A0A7Y9LEV1 | 3-112 | None |
| A0A2H0J5W7 | 12-113 | None |
| A0A4V0NDI8 | 2-117 | None |
| A0A1A3PWS8 | 35-164 | None |
| A0A4R1L715 | 211-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.