DPCstruct | MC14464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7KV73 | 6-110 | LHTATREKLRKFNSLRGREVSPGEFWDVVAVTAVDGSQKEAYELQIAEKVERKELPVGAQYQVFSDPPGRKIGNGGSTLYALQQLND… |
| A0A5F4D988 | 12-129 | LREAAQRKLRRFSELRGKPVAPGEFWDIVAITAADEKQELAYKQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALRCLEK… |
| A0A2P6NU58 | 157-253 | None |
| A0A0J1GD19 | 14-121 | None |
| A0A817R035 | 38-115 | None |
| A0A2G8LLS1 | 10-105 | None |
| A0A813M3Q8 | 12-110 | None |
| C1MRD4 | 47-156 | None |
| A0A673KH11 | 24-113 | None |
| A0A821MCH5 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.