DPCstruct | MC14463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F4D053 | 1-67 | MKAFLLTLAALVLLSQVTSGSAEKCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPKFQPTYSLWPD |
| A0A3L7HDZ1 | 1-59 | MAQWILLVVALLVLSHVPPGSNEFKRCWNGKGACRSYCMRQETYMHLCPDASLCCLAYS |
| A0A286Y187 | 1-82 | None |
| L5JZY9 | 1-69 | None |
| A0A091E3R5 | 1-72 | None |
| A0A6J3J7C2 | 35-102 | None |
| G1P4X6 | 1-71 | None |
| A0A4W2ELW3 | 14-80 | None |
| A0A7F8R2D3 | 12-79 | None |
| A0A4W2GZI4 | 31-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.