DPCstruct | MC14461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 157 ± 28 aa |
| Standard deviation of domain lengths | 28.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397V7V7 | 36-167 | LTKKQQLIKQSLETRKHFEQLSLEWQEKLYETVSLGILRDSAKFILPHHYQEIIEERNASKMCGYPICSKPKQVIQGQYRISYHERK… |
| A0A2U9BHA5 | 187-323 | FLEVLKEKLRMELKKRALKVVESLLEDSVAEDFLVDCAKFITRANYRDAVEERSIAKMCGYPICPNKLGKMPTQQYKICTKTNRVYD… |
| A0A0F4YSH3 | 151-305 | None |
| A0A183P5T2 | 164-331 | None |
| A0A3Q4M6P5 | 12-148 | None |
| A0A6P5W3V6 | 2-95 | None |
| A0A251T060 | 10-175 | None |
| A0A6J1GVD1 | 7-160 | None |
| A0A1V8STG6 | 59-220 | None |
| A0A0B0PVM4 | 9-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.