DPCstruct | MC1446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 123 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9UJ24 | 42-161 | EVESAQTPLTGKALLQRVKELGHLAKRETAKQCGYVKTSASGGVRTDLSGFYDAVLAAKGVKLDETSRDSRGKVATYKATVHKNGQL… |
| A0A1Z4T9G9 | 26-158 | MSETATAPLTGKALLAKVKELSTLPRRERAKQCGYYTTTKGGQVRVNLTDFYDALLSARGIPLSPESPKDGRGREPTYRVSVHQNGQ… |
| A0A1Z8SBM4 | 2-127 | None |
| A0A5K7YFP1 | 1-110 | None |
| A0A7C2NR02 | 7-112 | None |
| A0A6P0R2I3 | 12-143 | None |
| A0A2D5IDT7 | 9-140 | None |
| A0A354AXH3 | 14-147 | None |
| Q2JSN4 | 6-134 | None |
| A0A1Q4RYU7 | 3-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.