DPCstruct | MC14457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 225 ± 42 aa |
| Standard deviation of domain lengths | 41.66 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7A417 | 43-303 | RDFCQFLAREWVGNRPHSYAIPSRGKSSAWSRAVDGKWMAVGLADAASKYARSGKGFSENKAELDRLAADLQSAIYRNSSSDVCYIS… |
| A0A381VI83 | 30-237 | KKILDELKNKIKAFHNKKDKDPDQCYELIKEVFKWGGVWHVNKKGVSKVENKDHLIKLEDAIKEMNSQNPDLDVFDKERSRMNAGYT… |
| A0A0N1LA40 | 2-254 | None |
| A0A379IG36 | 206-437 | None |
| A0A3D5LKR5 | 57-328 | None |
| A0A5E6X6U0 | 10-187 | None |
| A0A7J5H816 | 44-285 | None |
| A0A2S4M8K7 | 16-219 | None |
| A0A173VPD7 | 47-283 | None |
| A0A069IKC6 | 79-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.