DPCstruct | MC14456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 251 ± 32 aa |
| Standard deviation of domain lengths | 31.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381UXZ4 | 1-242 | MVTKRERIISRRALLGGFGATLALPFLEGLGGKTLAAGLKGKDPARFACFYIPGAISQYKWFPEDTGTDYTIAPSHKPLTHHRDHFS… |
| A0A812ZC15 | 43-302 | IPTRFGTWSWGLGMSESIFVPRKTGPNFDLPEEIAALESVQKHINLYTNFHVFKDDAPNLCHHSGWVVLRSGIAPMTRENRPGETID… |
| A0A1Q7AM06 | 24-306 | None |
| A0A090WTJ2 | 2-283 | None |
| A0A6L8GFI7 | 8-317 | None |
| A0A388PFU1 | 4-229 | None |
| A0A2V8JZE1 | 828-1115 | None |
| A0A2S8FCF2 | 2-246 | None |
| A0A538Q3Y4 | 1-211 | None |
| A0A7C8D7Q9 | 10-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.