DPCstruct | MC14455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 24 aa |
| Standard deviation of domain lengths | 23.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1UWD6 | 31-164 | PGARSLINTGKATLRPKYGIMNLFGYDPKYKETLPYYDRFPLIFPLEPARGGFRGLNFHYLQPGARVAFLRQLAEYASDSNFDKKTR… |
| A0A381UU62 | 7-129 | MKGSNLVQKRRMTKARLTLFSYKAKHEKTLPYYDRFPLSMIIGKDVDGFIGLNFHYLPYQYRARLLDAVAFGNVINWNTLKRNKVTR… |
| A0A2E9PUQ4 | 34-148 | None |
| A0A496ZME6 | 22-220 | None |
| A0A661HJZ2 | 106-254 | None |
| A0A350PJ04 | 65-203 | None |
| A0A7Z9QIA7 | 87-256 | None |
| A0A2D8EN02 | 37-182 | None |
| A0A382JZW0 | 1-135 | None |
| A0A354GH62 | 4-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.