DPCstruct | MC14451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067GAP1 | 154-225 | GDSPVTTPQFYSASFLGDMQEVVAHVGSKYPKAHLYAVGWSLGANILIRYLGHESHSCPLSGAVSLCNPFNL |
| A0A1B7P7A1 | 221-287 | YNARATWDVRQIVGWLRGAFPQRKLFGIGFSLGANILTNYLGEEGESCPLSAAVICSSPWNLEVTSL |
| A0A453KV03 | 1-81 | None |
| A0A1E5VV67 | 191-277 | None |
| A0A2U1QFY0 | 617-685 | None |
| B5VT66 | 226-282 | None |
| A0A2G1XZV4 | 34-102 | None |
| A0A452Z701 | 8-89 | None |
| A0A453P6K5 | 37-114 | None |
| A0A1D6I517 | 31-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.