DPCstruct | MC14450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0EP83 | 1-80 | MPKTEIGADRFLHSHPHYDGRGALIAIFDSGVDPAAAGLQVSSDGKPKIIDILGCTGSGNIDTSKVVKANADGCTSGASG |
| A0A7N2N8D4 | 6-111 | FGESSGDDNGRLSNFKLNESTFLASLMPKKEIAADRFIESHPHFDGRGVLIAIFDSGIDPAAAGLQVTSDGKPKILDVLDCTGSGDV… |
| A0A0R0I859 | 59-150 | None |
| A0A1Y1L211 | 1-84 | None |
| A0A5E4QC44 | 1-102 | None |
| A0A6J1WFP8 | 58-152 | None |
| A0A4S4DEH1 | 175-282 | None |
| A0A3P7E9T7 | 3-87 | None |
| A0A2V7JC40 | 4-77 | None |
| A0A819CKW1 | 9-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.