DPCstruct | MC14449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9DFA7 | 41-104 | FPKGFFFTTSGGLQSYEHPLNEVKPVPRVDSKGDVCGTTYTVDAKAKKDTNIPRVGSAADWSSQ |
| A0A7N2N5D3 | 1-80 | MSMTTTLLIYLFLLFSKGCLFTSSGGLRSYEHPLNEVKPVPRVDSSGQVCGVTFTVDEESKREAIGMPRVGSAANWSSNY |
| A0A6A6LPK5 | 189-244 | None |
| C0HEQ9 | 123-183 | None |
| A0A4S8IZP0 | 406-465 | None |
| A0A7J6XES4 | 416-479 | None |
| A0A2P5WWG0 | 1065-1124 | None |
| A0A453M264 | 263-325 | None |
| A0A445DR77 | 255-320 | None |
| A0A1D6L7L6 | 557-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.