DPCstruct | MC14446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 824 |
|---|---|
| Mean domain length (aa) | 146 ± 33 aa |
| Standard deviation of domain lengths | 32.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 99.45 |
| Assigned Pfam label(s) | CL0277- CL0108- CL0123- PF09316- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0UE29 | 5-81 | LRRGPWTDEEDRILSSYIAKHGEGRWNSLARCAGLNRTGKSCRLRWLNYLRPDVRRGNISLEEQLLILELHSRWGNR |
| A0A2I7ZAS7 | 7-162 | CYKQKLRKGLWSPEEDDKLLRHITQYGHGCWSSVPKLAGLAETASLSVQTARGLQRCGKSCRLRWINYLRPDLKRGAFSQEEENLII… |
| A0A5K4FF61 | 30-217 | None |
| A0A0A0LUR0 | 20-98 | None |
| A0A1V9YTT0 | 15-220 | None |
| A0A1U7Y6T4 | 1-178 | None |
| A0A5N6PD63 | 9-123 | None |
| A0A5N6PUH4 | 5-110 | None |
| A0A5B6VVC4 | 4-127 | None |
| A9TCW1 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.