DPCstruct | MC14444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179IJV0 | 1-103 | MVRSFFRPSDDSTLYQYLVPANMMLAQGLVSCAVIMRGVDAELARDMEDMAAGIRKAIDDYAVVKHPKYGDIYAYEVDGFGSVNFMD… |
| A0A7G3GD27 | 1-108 | MGLIASMFRPSDDATVFPFLVPSNFLLLLAYASSLICSARYLAIAPLPANEALADEVAVALQQCAIVQHPKHGVVYAFEVDGYGSVL… |
| A0A813VMG3 | 320-426 | None |
| A0A1Y3Y603 | 109-209 | None |
| A0A7S1T0Q2 | 131-262 | None |
| A0A1G4MA88 | 344-468 | None |
| C1FZ18 | 840-967 | None |
| V7ZL68 | 112-226 | None |
| S2K2R1 | 661-800 | None |
| I1C339 | 215-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.