DPCstruct | MC14443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 287 ± 50 aa |
| Standard deviation of domain lengths | 49.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7G3X3 | 42-334 | QHYLDGALSFSTSSTGAATLNTAASYFFTQNSSLAQSPAAAGPQMMTTGTSTVDPALAVPTPTGQRYLVDGSVVVEAVPAQVRISYN… |
| A0A7G3GCR1 | 43-353 | LAQYSSSEVNLNNVLQNEILHLDSVQTISTANGKQEASIDRYDTISIKDKAFREEQFNFDSKNLQWQNIPLNNNEALYLVDGKWEKL… |
| A0A1T1JGN6 | 141-408 | None |
| K1JW03 | 55-389 | None |
| A0A644ZVD3 | 164-487 | None |
| A0A439EZZ2 | 78-384 | None |
| A0A3S0ULU3 | 5-230 | None |
| A0A656Q8F8 | 13-254 | None |
| A0A432SQT7 | 82-390 | None |
| A0A1G5QNJ7 | 282-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.