DPCstruct | MC14441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XAV4 | 7-122 | SLTPAQALEKLDALYEQSVNALRSAISEYIESGKLPDEKARTQGLFVYPSLSVTWDGSASSNPKTRAYARFTHSGCYSTTVTRPALF… |
| A0A377SXH9 | 18-130 | HTDPLEALAQVRLIYESSVTHLRDAMQRFVAGEALPGHVRAYYPFVRIQTDTVARLTNESAHLSYGFVAGPGSFETTLTRPDLYDKY… |
| A0A4U9D357 | 9-143 | None |
| A0A7J6YW69 | 411-524 | None |
| A0A6N3UG82 | 2-112 | None |
| J8VP58 | 6-138 | None |
| A0A7H4MNC4 | 1-104 | None |
| A0A2X3JY55 | 1-89 | None |
| A0A448BYI9 | 1-126 | None |
| A0A2R7SUD2 | 9-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.