DPCstruct | MC1444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 137 ± 31 aa |
| Standard deviation of domain lengths | 30.74 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225E2D3 | 104-261 | TEIVPLPVPEKFRKVDSQNLSAERRNDSWQVWTAGKLLHDFGQSRADAKEALQTFHDLRPTEWAFIGTQRVVAEYGLTNGKPVLATV… |
| A0A1Z4SQ61 | 44-202 | LLTQKQASKEDCIAFNPNNIAVKQVNGSWKIVENGNHWMFDFGANKDEATRAFQVIKQYSMSKSCFVGRPQPSFKYLLTNNNAPSGA… |
| A0A849KC82 | 11-94 | None |
| A0A1F9CVK8 | 204-294 | None |
| Q05VF3 | 457-612 | None |
| A0A7T9IDL9 | 1-127 | None |
| A0A328FAA3 | 50-163 | None |
| H5SD06 | 2-148 | None |
| A0A7C4A7Z8 | 460-614 | None |
| A0A846MY44 | 191-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.