DPCstruct | MC14436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 89 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.01 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | CL0317- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4W1Q1 | 130-184 | RPRGEGMTPYQGKKRCFGEYKCSKCKRKWMSGNSWANMAQMCKKCRLFVYPHKQV |
| A0A6J1NAG0 | 9-94 | EAKEGEGLTPYQGKRRSFGEFKCPQCQRRWMSANSWANSGQDCSKCKINVYPHRQMRLDNPGGLDKSDPTKRHPRELCQRCREIGD |
| K7F236 | 89-182 | None |
| A0A6S7GWR7 | 579-662 | None |
| A0A6S7G597 | 970-1055 | None |
| A0A7M5V1D2 | 11-100 | None |
| A0A7R9KQE8 | 365-465 | None |
| A0A182FU96 | 326-418 | None |
| H3BGB9 | 24-106 | None |
| A0A812QIS0 | 272-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.