DPCstruct | MC14434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IR92 | 1-115 | MLVRSGHAMIVAMLLIALVFLCSLYAADAQSNFRRSHIRMQKLCSRKLSDALYLICRERGYNEPFSYSNEDEPRVDPGPGLVDECCY… |
| A0A6J1N1I9 | 1-102 | MKIQLILAPLAAVCVLSLVVSEVHSRKFCGRDLSVALDLICNGNLIKRSGMRERVNKITVLKWPWIPTHKALSLNRKKRNIVEECCH… |
| A0A7E4S8S2 | 2-85 | None |
| A0A5Q0TX30 | 9-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.