DPCstruct | MC14433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5V0E8 | 171-270 | DVVRRLYDVRPASYEELLLFQGVGAATVRALALISCLIYGVELDWRDPIKYSFAVGGKDGVPYPVSRRRMDEVIEFLEGVLERTAVE… |
| A0A1W9MCP3 | 3-107 | SERIAKALNFAYESQPKNYEDLIAIKGVGAGTVRVLALLSDLVYGEKPSWKDPVKYSFAHGGKDGYPYKVSRKLLDKSIEILKTGLE… |
| A0A7X6XV53 | 14-116 | None |
| A0A256YCY8 | 271-381 | None |
| A0A7G9Z113 | 28-119 | None |
| A0A7C4AWP8 | 76-181 | None |
| A0A7C5SMP9 | 160-261 | None |
| A0A842XI20 | 82-200 | None |
| A0A7J4F6T4 | 200-317 | None |
| A0A7C7VQ84 | 38-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.