DPCstruct | MC14431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 4.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379FFQ6 | 2-53 | QMLTLEEWAQERYKSRPPKLGTLQRYARGGLFYPPARKEGGIWRVREDADLV |
| A0A829G7C0 | 1-53 | MSRLITLQDWAKEEFGDLAPSERVLKKYAQGKMMAPPAIKVGRYWMIDRNSRF |
| D2AH98 | 31-94 | None |
| A0A220Q5V8 | 1-64 | None |
| A0A3L6LY39 | 46-102 | None |
| A0A2P1VM00 | 12-75 | None |
| A0A4Y8N191 | 11-64 | None |
| A0A848HKV3 | 89-153 | None |
| A0A3S0WIZ5 | 1-64 | None |
| A0A7Z1GA87 | 102-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.