DPCstruct | MC14430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9HJX1 | 40-95 | SVKWDERVHMIVCDHLSPIQSSMTGNYRFYGPDFSFDAYRFENGIWVYVPDINITN |
| A0A7X9JMA6 | 1-61 | MSCRYDESLDAIIFDHLVPASNIYQGMYEFYGPNGTYDAYFKKKNMWMLKEDIEPKNPRKK |
| A0A7C6MR79 | 403-467 | None |
| A0A660W4G8 | 68-126 | None |
| A0A7C3DXA0 | 132-193 | None |
| A0A661XQQ4 | 39-112 | None |
| A0A350JM31 | 53-125 | None |
| A0A2E1CEG3 | 186-253 | None |
| A0A4Q8RU57 | 353-411 | None |
| A0A1Q3ZM25 | 217-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.