DPCstruct | MC1443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 297 ± 50 aa |
| Standard deviation of domain lengths | 49.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5XFT6 | 4-279 | LIPYDVNSPLWSDGAQKERFLAVPDGKTIHVGPDGDWDFPEGSVLVKTFLLEGTRVETRLFMRHPDGVWAGYSYEWNDAQTDATLLD… |
| A0A2E5QM45 | 394-682 | EAGVVAYQVNSEGWNDGATSQRWMAVPESKKAVYKNDQPWDFPNGTALAQTLSLPAGEGGPARKVETRVLLRQQNEWQGYSYRWNKD… |
| A0A7C8DHW7 | 179-456 | None |
| A0A7Y4ZR37 | 52-356 | None |
| A0A3E1EP57 | 734-1032 | None |
| I2JNN1 | 800-1167 | None |
| A0A2S5TIM0 | 556-914 | None |
| A0A812NM01 | 656-982 | None |
| A0A317EH49 | 70-353 | None |
| I0KC25 | 7-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.