DPCstruct | MC14428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388NL95 | 13-77 | VKARGVQVAMLCVPGQHAQSVTNTLVDAGVRSILNYAPVNLSVPAAVRVQYIDPVIELQRMSYFL |
| A0A7X9HJR5 | 2-71 | SEKNISIAMITVPVDHAIEVTNELVLAGIKGILNFTTVPVTVPPHVYLEEYDMITSIEKVAYFVTSMQKQ |
| A0A7V9QAT0 | 1-58 | None |
| A0A7X8ECT6 | 63-144 | None |
| A0A7V9JV51 | 13-97 | None |
| A0A370IAG2 | 149-229 | None |
| A0A2N2H2Q2 | 111-193 | None |
| A0A7V5RZW7 | 2-83 | None |
| A0A7V3RDL1 | 6-73 | None |
| A0A2S3U071 | 41-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.