DPCstruct | MC14426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 3 aa |
| Standard deviation of domain lengths | 3.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0NR10 | 287-367 | YAAYKVADSVKRHEAWGLGSYCFFNTNKSVTAEHAFEVPQSPDVRFHDMVTVSLGGTGTINHVINGTGGPSDANSNVANVT |
| A0A7X9FA52 | 1-82 | YASYKVADNVTSHQAWGLGIYNVFYDAPVIVDNAIETPAHLEESIIHKVIFWLNGNRESVVRSIINGKGGQVDVNNRKAAMK |
| A0A7S4GPW8 | 254-334 | None |
| A0A085VZK4 | 457-542 | None |
| A0A1C1A4V9 | 517-601 | None |
| A0A1Y2TK57 | 768-853 | None |
| A0A7S2C275 | 6-90 | None |
| A0A7X9IC44 | 54-135 | None |
| W3X927 | 489-574 | None |
| A0A1F3NQN4 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.