DPCstruct | MC14425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 16.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0KAR5 | 8-153 | IDTCVSIDTFAPQFLWLLIVAAPRSTLTRSVMGSIGPILALSLVHLAVVITAASAPGGTEPIAIFADVFDPAKNQLEGMERLFAVRD… |
| A0A7R8AZD6 | 3-141 | PFELSNVVVLPFWALMILAPLWSVTRRLIGSPWIVAPPALIYLATLVPVASIVLPAVVNPVPAEIAALLGTPTGTALAWAHFVAFDL… |
| A0A803LAW1 | 44-189 | None |
| A0A7S3V3A9 | 13-157 | None |
| A0A3L7YS58 | 7-137 | None |
| C1EE22 | 65-251 | None |
| A0A354VZQ8 | 28-169 | None |
| A0A2S0UKL2 | 9-107 | None |
| A0A0G4H0Z3 | 69-226 | None |
| A0A2E5RW95 | 59-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.