DPCstruct | MC14422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7Y304 | 19-89 | EGAPVHVAADQLEPDTLRAVIESFVLREGTDYGLHETSLEDKVAQVLRQVQRGEVHITFDPGTASVNLVVA |
| A0A2E6YXK3 | 5-69 | LIEIPYLELSEMALESIIDEYVTRDSGIYNGSLSDKRALIVMALQKSEVVITFDPVSGSTDIVEK |
| A0A7S9E1I4 | 1-62 | None |
| A0A0W0YKI8 | 24-110 | None |
| A4A3J3 | 4-72 | None |
| A0A376Y1F7 | 146-205 | None |
| A0A6V7KGZ7 | 235-304 | None |
| A0A7T4YDT9 | 1-73 | None |
| A0A3M5PAR4 | 40-120 | None |
| A0A142BFI6 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.