DPCstruct | MC1442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9LVW9 | 1-158 | MGQNAVFSESGEVQPAQGRPIQEGWTLGRSAESITDHNEREYARVASYMMPIRDAIMCDLDETSLTIWQTLTEILRLNNIKTVQDLS… |
| A0A2E5QM40 | 40-213 | GQPGKEKPGGNKSPRQFTIPHALDPALVKEGYNLVVDKNGNEVLPQGRPFQEGYKLTKTTVTVKSHNKRAYAKVFAIMAPMRDALIF… |
| M9RBJ4 | 149-346 | None |
| A0A812HCW7 | 26-215 | None |
| A0A2E8D062 | 147-352 | None |
| A0A381NNM4 | 408-586 | None |
| A0A5N9F642 | 111-332 | None |
| C1E927 | 6-168 | None |
| A0A1Q9GMD6 | 107-288 | None |
| A0A381TSF1 | 26-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.