DPCstruct | MC14417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 566 ± 149 aa |
| Standard deviation of domain lengths | 149.00 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 64.44 |
| Assigned Pfam label(s) | PF06761- PF21070- PF14331 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A501WIK9 | 157-540 | PPAREAEPPPWGLIVPLGVALVLAAWSGWAEWRYAAGLVAEIPRAETVIAAGSADPGAATRALDDLRRAMEEVEARAGEGPLGLAPF… |
| K8CGM6 | 121-699 | PDRLTPPGVQQGLANHSHDFLLRLGWQLRNGMAERFHTLAVSLLSGPYAVPLRGVMFSPPLSPKAGTDKQRWLPDNSWNAILDDLPG… |
| A0A0C5W4G9 | 49-853 | None |
| A0A6N6IK60 | 2-469 | None |
| A0A2X3CIW1 | 48-485 | None |
| D0XF20 | 233-884 | None |
| A0A1I3NGR2 | 52-658 | None |
| A0A7W5HH50 | 77-674 | None |
| A0A377XBL2 | 105-606 | None |
| E9XU18 | 78-823 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.