DPCstruct | MC14416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 264 ± 52 aa |
| Standard deviation of domain lengths | 51.93 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388KGJ3 | 42-360 | EEEEKRKAKEAKEKALRKRKERQDFEERIGSIVGSKINDACELFLGKSYAQRHVSAPDASRRSHIEVERERLERQVDTLRREYETIK… |
| A0A388K7Q8 | 2-190 | EEEIARLKKANADALGAVETWKTKALRPGNKRGSVAVTPSLVPRSRMRTRLTPTVSPPFHKEQAKQAMAEQEHEIELLKKWRLRNLN… |
| A0A388KJB9 | 6-193 | None |
| A0A388KIQ7 | 140-424 | None |
| A0A388KIH0 | 9-243 | None |
| A0A388KFM5 | 237-520 | None |
| A0A388KC13 | 152-400 | None |
| A0A388LIA7 | 52-277 | None |
| A0A388KEF6 | 17-336 | None |
| A0A388KEH5 | 9-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.