DPCstruct | MC14411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 73 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 74.80 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF00223- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VNU3 | 1-53 | MDNGDGIAVGWLGHPVFRDKEGLELFVRRMPTFFKTFSVVLVDEEGIVRADVP |
| A0A388KAH2 | 1-82 | MDNGDGIAVGWLGHAVFKDKEGHELFVRRMPTFFETFPVVLVDEEGIVRADLPFRRAESKYSIEQVGVTVEFYGGELDNVSF |
| A0A453DVM0 | 76-133 | None |
| A0A7J9GPF4 | 1-61 | None |
| A0A287U567 | 146-204 | None |
| B9SD21 | 101-208 | None |
| A0A1S4AEF0 | 28-131 | None |
| A0A7J7LK22 | 267-325 | None |
| A0A453N3H7 | 2-77 | None |
| A0A445I2G0 | 56-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.