DPCstruct | MC1441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5ZBU6 | 98-151 | SWTDKTILKAGEYVSKLKKNINAPDGKIVYGTYRNVRIGLIKRDNKIVSFFPDS |
| A0A0R2KG27 | 2-63 | WFPKSWTAKDIKRAGNHVASLKVNKHKKSGEHMTGTWKGVKVVVIKGKDGKPSTICPDYKQP |
| A0A1H3MQB3 | 200-266 | None |
| A0A1G6RVB8 | 54-109 | None |
| A0A315Y2I0 | 296-357 | None |
| A0A6B4LBB6 | 272-333 | None |
| A0A0J7DBX4 | 30-91 | None |
| A0A430FMR7 | 93-157 | None |
| W7DCI7 | 141-202 | None |
| A0A2B1FS58 | 5-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.