DPCstruct | MC14409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388K5A3 | 4-114 | MAPRTESQGADEWLLTIQEGCDRLRSMVEALSVRGGDWLEAEGGAAALIPWQDDTMQSTVDAIWELEEGPAPRLDEFVDWRQAETLM… |
| A0A388LYM5 | 138-249 | GELQRGADEWLIIMENGCRRLQELVGELSVRSNEEPGIDGGAISLADWLNDTTEDILDVMWELEEGPDPRLEAYIDWWWADGIMATR… |
| A0A388LKU0 | 4-121 | None |
| A0A388LG15 | 1-126 | None |
| A0A388L7L6 | 5-134 | None |
| A0A388L6G6 | 1-120 | None |
| A0A388L3J8 | 3-113 | None |
| A0A388KUL9 | 11-119 | None |
| A0A388LDD9 | 3-107 | None |
| A0A388JWL1 | 329-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.