DPCstruct | MC14407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 20 aa |
| Standard deviation of domain lengths | 20.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2H523 | 77-233 | LSAPISALQVTQTRQGITSRHVLAYLPESHGIVGIPRAIIEPRRPVGRDPTPAEAEEGLFKYHPAIEVDPKSVITHERDVLGVEKII… |
| A0A388K3P2 | 30-184 | YFLSTVKTIAVTTTARGITAKQLLIATVSDQILSLDKRYFDPRRPLIPTAADREEGLMPYTDTLPIPPQSHLTHGYQVMGIREIVTL… |
| A0A1A8ZX33 | 967-1100 | None |
| A0A7S2UA25 | 31-157 | None |
| A0A1I8FCP9 | 131-240 | None |
| A0A178F2X6 | 1063-1218 | None |
| A0A0A2V5P3 | 1291-1400 | None |
| A0A0G2G635 | 1097-1215 | None |
| A0A183K9X9 | 324-448 | None |
| Q22C90 | 801-928 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.