DPCstruct | MC14406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834Y7P1 | 4-94 | ATDRLNKMVDSYGRRLAKEYNRVLMRRLRTRQTAESTLLLLKKEAIEALPENLKTIALVPDLTPFPANRFMATLTPPIEGYIEKIME… |
| A0A388K293 | 46-183 | ISKSAKSKAAKTPKAKAEPAKGKFDGLLDKYLQPLAHPSEASSSTEEQRQREREMASQYSRLLMGRHRAEMKALNLQIQLKEAAIAA… |
| A0A7R9TUP7 | 20-132 | None |
| A0A6A6MZK8 | 69-204 | None |
| A0A6A2WRI2 | 1-164 | None |
| A0A3N6UEX9 | 94-231 | None |
| A0A834YQ60 | 127-264 | None |
| A0A0B2R652 | 61-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.