DPCstruct | MC14404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 265 ± 41 aa |
| Standard deviation of domain lengths | 40.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388JYW1 | 31-351 | KGVNREGKGVDSSSRTALSELEQEIAVVEALSDKLKKLNKAYEPEFISLTHIAEGKAPQVLGQAHSAKLTLMSTRPLVAARYMERKK… |
| A0A388JTM4 | 303-530 | KSGDHETDEATNGREEDEQMEEEKRQAAILEAQINVLKDQNRELEADTINLQKIASSSHTDIKAAAKLYARHNPGKRVILPFRWNNG… |
| A0A388K624 | 1-230 | None |
| A0A388K500 | 376-599 | None |
| A0A388KL81 | 54-327 | None |
| A0A388LIB8 | 2-176 | None |
| A0A388L260 | 41-312 | None |
| A0A388LAH6 | 308-637 | None |
| A0A388LHL2 | 95-395 | None |
| A0A388JXB5 | 259-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.