DPCstruct | MC14402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 338 ± 41 aa |
| Standard deviation of domain lengths | 40.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388M3L4 | 184-526 | EFLSFNDWAELIYLYRHRRNEFVDTLNRMARATIVVDEAMKVEDRTINTSTIDAEVKFVGIWGADSQFHKERVVRGVVIADEVALED… |
| A0A388JSD4 | 92-508 | PPLISILSFDNWADLLWTASHDKPAFRRLTEDRVTHAPEQLMEDELVDLCVNNNLAIKEKRFIELWGAESDFHAGLIQADPDIPTGL… |
| A0A388KFE8 | 52-417 | None |
| A0A388KG07 | 481-767 | None |
| A0A388KG78 | 250-559 | None |
| A0A388KN98 | 93-482 | None |
| A0A388KXF4 | 713-1043 | None |
| A0A388LEK4 | 49-413 | None |
| A0A388LCT6 | 17-398 | None |
| A0A388LDZ0 | 19-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.