DPCstruct | MC14400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 140 ± 37 aa |
| Standard deviation of domain lengths | 36.50 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4JZT6 | 3-141 | RSTVGVVVKSEACHPYEPFKCPGDGACISIQYLCDGAPDCLDGYDEDSRLCTAAKRPPVEETSSFLQSLLASHGPNYLEKLFGSKAR… |
| W6UXV2 | 2-93 | KEAVPVGNGCPVTAPWPCQQYSFCLSFAFVCDGEIDCPDGYDENPRLCVAKNRPAVALLEGFIRKYRDWLVPKYLGDGETKFIAYNL… |
| A0A0N0U714 | 1-173 | None |
| A0A4E0RVI6 | 19-179 | None |
| A0A815LZ21 | 17-157 | None |
| A0A7E6FP00 | 110-278 | None |
| V3ZWS4 | 86-212 | None |
| A0A2A2KR90 | 5-109 | None |
| A0A291C211 | 147-320 | None |
| A0A817WAI7 | 61-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.