DPCstruct | MC144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8J989 | 161-298 | LTINEFVSNYNKKDGLKKGGSLCFYGHWFGRPYDNFHQIESLSFDSSTNKLSLTFDEKETLIIVNPKEISESEKILTIKSADKIIWN… |
| A0A1U9JL21 | 7-119 | QHWLLQPFGCVRFWRFALVRPNDQQFILTAVHAEGARLDLSVAHASHSGHATMLSVWDAQGWQRSGSGVTLQHASRLRWDDNEAWLD… |
| A0A7S7NV06 | 3-137 | None |
| A0A1I7AP22 | 106-227 | None |
| A0A1Y4RGL7 | 137-273 | None |
| A0A7Y3PJS5 | 13-124 | None |
| A0A4R1QZU9 | 107-226 | None |
| A0A4Q4KFM4 | 69-199 | None |
| A0A519ZAD4 | 67-218 | None |
| A0A363U4U6 | 12-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.